Monday, March 21, 2011

Protein Patties

Wow! 2 posts in one day. From polygamy to protein patties...what a beautiful alliteration.

Lately, I've been feeling like a bad mom. It's hard to constantly have healthy snacks and meals on hand for Tucker to eat. He grows tired of the same fruits over and over and like his mama, he loooves his carbs. So, he's always asking for crackers and cookies...ahh!

Anyway, until last week I had forgotten about a recipe that I got from a girl a while ago. I think she called them protein patties and they're packed with good proteins. This is a really good snack for Tuck b/c he's not always so good at eating meat.

And they're not just for chillun'. If you find yourself needing to eat healthier snacks, I really recommend them! (But be warned, they aren't going to taste like Doritos...they taste healthy but they're still really good.)

Protein Patties
This just made about 35 patties but I make them rather small

* 2 C cooked brown rice
* 1 1/2 C grated cheddar cheese
* 1 1/2 C grated carrot
* 1/2 C raw sunflower seeds
* 1/2 C sesame seeds, raw or toasted

* 3 eggs
* 1 tsp dried basil
* 1 tsp salt
* 1/2 tsp black pepper
* 1 1/2 C peanuts (or toasted slivered almonds)


1) Preheat oven to 350 degrees. Spray a baking sheet with non-stick spray.

2) In a mixing bowl, combine the first 5 ingredients (rice, cheese, carrots and seeds)



3) Put peanuts in food processor for 5 seconds (I think I did 10) but the directions said not to over process b/c the texture of the peanuts is important. Add to rice mixture.

4) Combine the eggs and seasonings in the food processor and blend for about 5 seconds.

5) Add to rice mixture and mix thoroughly.



6) Scoop mixture onto baking sheet, and form into plump patties



7) Bake at 350 degrees for 15 minutes, then turn patties over and bake 10 min. more.

8) Transfer patties to rack to cool, flipping them so their toastier side shows.
If you're not eating them the same day, keep in the refrigerator. They will keep at least a week if kept cold and stored in an airtight container.

3 comments:

perfectlyimperfectwithstephanie said...

Those looks super yummy! I'll have to try them.

Faith said...

yum! thanks for the recipe:)

Mathews said...

Your blogs always leave me laughing, totally provoking deep thought, or hungry! Thanks for a yummy post!